PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g24900
Common NameGSCOC_T00028826001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family HD-ZIP
Protein Properties Length: 313aa    MW: 34781.2 Da    PI: 9.121
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g24900genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.8e-18138192256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Cc02_g24900 138 RKKLRLSKEQAALLEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 192
                  788899***********************************************98 PP

2HD-ZIP_I/II126.89.2e-41138227191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq++lLEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Cc02_g24900 138 RKKLRLSKEQAALLEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVNELR-AL 227
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.2E-261118IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.01E-18130195IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-18133197IPR009057Homeodomain-like
PROSITE profilePS5007117.394134194IPR001356Homeobox domain
SMARTSM003897.4E-15136198IPR001356Homeobox domain
CDDcd000861.44E-14138195No hitNo description
PfamPF000461.4E-15138192IPR001356Homeobox domain
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
SMARTSM003401.5E-26194237IPR003106Leucine zipper, homeobox-associated
PfamPF021834.4E-11194228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGEKDDGLRL SLSLGCGDDE KREKISQSPQ PFPLKLMRST LPFVQQRNQQ QLLLLQKSSF  60
LADAFPSSSE RNAAEPRSSL RGIDVNRPAT VIDCDEEVMV SSPNSTVSSV SGKRSEREEN  120
EAERGSSSLE DDGGDAARKK LRLSKEQAAL LEETFKEHNT LNPKQKLALA KQLNLRPRQV  180
EVWFQNRRAR TKLKQTEVDC EYLKRCCENL TEENRRLQKE VNELRALKLS PQFYMNMNPP  240
TTLTMCPQCE RVAVSASSSS SAAAASTSLA ATSTGIPRQP NPLTGSNQHS MPKNPWAAIF  300
PNQSHGVRQP RS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186194RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-137PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466024e-90HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP950.0A0A068UP95_COFCA; Uncharacterized protein
STRINGVIT_00s0299g00100.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-75homeobox protein 2